General Information

  • ID:  hor006430
  • Uniprot ID:  P52211
  • Protein name:  Osteostatin
  • Gene name:  PTHLH
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  TRSAWLNSGVAESGLEGDHPYDISATSLELNLR
  • Length:  33(143-175)
  • Propeptide:  MLRRLVQQWGVAVFLLSYSVPSCGRSVEELGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLNSGVAESGLEGDHPYDISATSLELNLRRH
  • Signal peptide:  MLRRLVQQWGVAVFLLSYSVPSCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:   Q9TU31
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P52211-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006430_AF2.pdbhor006430_ESM.pdb

Physical Information

Mass: 413081 Formula: C153H240N44O54
Absent amino acids: CFKMQ Common amino acids: LS
pI: 4.26 Basic residues: 3
Polar residues: 13 Hydrophobic residues: 11
Hydrophobicity: -42.42 Boman Index: -6379
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 88.79
Instability Index: 4445.45 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  7642102
  • Title:  Sequences of the cDNAs encoding canine parathyroid hormone-related protein and parathyroid hormone.